Friday, June 14, 2013

White House Dizzown

Good Afternoon Ladies & Gentlemen,
 
Oh I’m so excited for the adventures this weekend for Dizzy’s birthday celebration Part Two (since last week was more family based). I wish I could tell you more… but she reads this thing… and it’s surprises… so tune in next time.
 
In the meantime, we got to see a special sneak preview of “White House Down” starring Channing Tatum & Jamie Foxx. Now, this is not to be confused with “Olympus Has Fallen” which came out a few months ago, but it’s basically the same story from what I understand (have yet to see OHF). Did I mention this was free? Okay, so the story is about a young security officer (Tatum) who just bombed the interview for his dream job with the Secret Service & impress his estranged daughter… but they still get to check out the White House & even meet the President (Foxx). Then a paramilitary group takes over the White House, takes out the Secret Service… and only Magic Mike can save President Django. From the director of “Independence Day”, “2012”, “The Day After Tomorrow”, “The Patriot”, “Stargate”, “Universal Soldier” & “Godzilla” you basically know what you’re going to get. Lots of action & explosions, lots of convenient foreshadowing, predictable characters, one-liners, and plot holes the size of America’s influence… but for an action flick, it was pretty decent. Two movies that kept popping into my mind were “The Rock” (basically a frame by frame storyline replacing Alcatraz with the White House) and “Die Hard” (Tatum’s wardrobe, the daughter in danger, terrorists/hostages, etc) but I definitely don’t put it on the same level as those two. It’s okay… but those are legendary. Okay, legendary is a stretch but you get it. I don’t want to give away any spoilers… but you know it has a happy ending, right? Okay… so… along the lines of “Man of Steel” were there was all this destruction & drama & all the things that were “important” five minutes earlier… and all of a sudden it’s wrapped up & everything’s okay… they fly off into the sunset, daughter in hand, President spitting out jokes… for f**k’s sake, I kid you not, they basically said that world peace was imminent at the end… and I wouldn’t have been surprised if a f**king puppy ran up into Channing Tatum’s lap aboard the Air Chopper One or whatever it’s called. It’s that bad or a story… but hey, it’s an action flick, so you give it a LOT of disbelief. I’d say check it out… and now I have to watch “Olympus Has Fallen” to contrast & compare. Damn it! Anyway, here’s some news…
 
Dino Update - A fossil largely forgotten inside a Chinese museum might actually contain the world’s first bird. Nature magazine reports that the Aurornis xui specimen was technically discovered by a Chinese farmer several years ago. But it had remained unidentified until paleontologist Pascal Godefroit stumbled across the fossil last year in the museum at the Fossil and Geology Park in Yizhou. “In my opinion, it's a bird,” Godefroit, who is at the Royal Belgian Institute of Natural Sciences in Brussels, told Nature. “But these sorts of hypotheses are very controversial. We’re at the origins of a group. The differences between birds and [nonavian] dinosaurs are very thin.” Godefroit and his team of researchers have written a paper on the Aurornis xui that was published in the latest issue of Nature, where it is described as the "most primitive" bird specimen yet discovered. So, why is there a debate on whether the specimen should be considered the world’s first bird? First of all, the Aurornis xui, aka Aurora, most likely didn’t actually fly. “Okay, that’s settled then. What? There’s more? Okay, go on.” Instead, it’s believed its four wings were used to help it glide through forests during the late Jurassic period about 150 million to 160 million years ago. Luis Chiappe, director of the Dinosaur Institute at the Natural History Museum of Los Angeles in California, told Nature that he believes the Archaeopteryx is still the first known “bird” in history, describing Aurora as “something that’s very close to the origin of birds, but it’s not a bird.” In addition, Paul Barrett of the Natural History Museum of London said for now it’s impractical to distinguish which of the two species were in fact birds. "There's such a gradation in features between them that it's very difficult to tell them apart,” Barrett told Science News. Aurornis xui "is certainly an older member of the bird lineage than Archaeopteryx, and it's fair to call it a very primitive bird. But what you call a bird comes down to what you call a bird, and a lot of definitions depend on Archaeopteryx." Nonetheless, Godefroit said the Aurora has hip bones that strongly resemble modern birds. And because the feather fossils are not well preserved, researchers cannot say for certain that the 3-foot-long Aurora was a glider rather than a full-fledged flier. Its length puts it at about the same size as other modern-day pheasants. However, the Aurora is described as having razor-sharp teeth, claws and a long tail that make it sound far more formidable than your average bird. In April 2012, the remains of a giant feathered dinosaur were discovered in China, marking it as the oldest known feathered dinosaur in history. It was estimated to have lived about 10 million years after Aurora. In addition, Godefroit says Archaeopteryx is more closely related to nonavian dinosaurs, meaning that birds would have needed to experience two separate forms of evolution to become the flying creatures they are today. Interestingly, the answer to the debate might lie in the same museum where Aurora was discovered. Godefroit says hundreds of unclassified fossils remain there and at other nearby institutions. “The biodiversity of these small, birdlike dinosaurs was incredible,” he said. So… dinosaurs are interesting… this article, not so much. Kinda sounds like somebody who’s just trying to get into the papers. Like if I were to say to the scientific community, “I’ve figured out that cold fusion thing! You’re welcome…” “That’s great, how does it work?” “Well, it’s not really cold FUSION as you know it… more of a cold fission.” “FISSION? My goodness, I’m… wait… how does that work? That doesn’t really make sense.” “Yeah, totally… because it’s more of a… cold fizzing, that happens readily in nature.” “What?” “Yeah, it’s a cold fizzing beverage… that I have in my hand. Do the Dew, scientists! (Gulp gulp gulp)” “Sir, you’ve wasted our time…” “(Sip) Aaaaah… Yup, totally…”
 


 
The New Woody – Some people just have gifts… burning passions that they want to test their limits on every day & just making amazing things, even if just to themselves. This next story… is about one of those people. Putting all other do-it-yourself projects to shame, a Hungarian farmer spent the winter building a car made almost entirely of wood. That’s right, f**k your Prius! THIS is the green automobile. What did this marvel of engineering prowess have to say about his accomplishment & setting the auto industry on its f**king ear? "I love to work with wood," Istvan Puskas, a 51-year-old from the village of Tiszaors, said in what should be considered the biggest understatement ever. The frame, axles, gears and even the gas tank—which Puskas fashioned from an old beer barrel—are made of wood. The engine (from a Fiat 126), steering wheel (from an old Mercedes-Benz) and windshield are virtually the only parts that are not. "My aim was to make it out of wood as much as possible. A wooden car must be made out of wood." Best part: The wife was supportive… though not how you might think. Puskas' wife encouraged him to build the car… rather than spend the winter at the pub. "There's not much to do here," Iren Puskas admitted. Last year, her husband built a fully functioning wooden motorcycle. Istvan Puskas says he started building the wooden car around Christmas. Hmm… I wonder if elves helped a bit… they’re historically pretty good at twiddling toys. According to London's Telegraph, the vehicle cannot be officially registered, but police allow him to drive it on the village's local lanes. However, Puskas plans to sell it. "I have no place to store it. I have no garage. I have nothing. It can be good for a collector, for somebody who likes nostalgia [and] for somebody who likes to drive slowly." He added that he'll use the money from the sale for his next project: a three-wheeled car. So if you’re interested in purchasing a fully functional wooden car (and you could probably get a good deal from a Hungarian farmer) then reach out to Istvan (I think that’s Hungarian for $teve by the way) by hitting him up on… Face… book… wait, how do you reach him? Sigh… come on journalists!!! If you’re going to bring this story to the masses, then at least give the masses some information. F**king media… oh well, as long as they get paid, right?
 
Tebow Update – After last year’s fiasco with the Denver Broncos & New York Jets, Tim Tebow is back on the field with an NFL team… and best of all, it’s the New England Patriots. The Patriots announced the signing of the former Jets quarterback on Tuesday, six weeks after he was cut by New York and just in time for the start of the three-day Patriots minicamp that runs through Thursday. Tebow practiced with veteran New England starter Tom Brady and backup Ryan Mallett. The newest Patriot wore No. 5, not his familiar 15 (which belongs to Mallett) on his shorts and helmet. The QBs wore red jerseys without numbers. "First and foremost, I just want to thank the Patriots for giving me an opportunity. I'm very thankful," Tebow said on the field after practice. "It's such an honor to be a Patriot and play for Coach (Bill) Belichick and for Coach (Josh) McDaniels, learn under Tom (Brady), and be a part of this very successful franchise." Two people with knowledge of the deal told The Associated Press that Tebow was signed for two years with no guaranteed money. One person says he will make the veteran's minimum salary, $630,000 in 2013, with incentives. The people spoke on condition of anonymity because terms of the deals had not officially been announced. "Anything we do, we feel is in the best interests of the team," Belichick said at a standing-room-only news conference before practice. "We'll see how it goes." Let the media circus begin!
 
Allow me to provide a little recap of the Tim Tebow story for those who may not be familiar. While at the University of Florida, he was an option-style quarterback, won a Heisman & two national championships… but everybody said his style wouldn’t translate to the NFL. Oh… and he’s also basically the 2nd coming of Football Jesus, devout Christian (like… DE-VOUT!!!), one of the nicest & well-grounded individuals you will ever find, has a movie star smile, a master of the lost art of humility & allegedly a virgin… but still, the NFL is skeptical of that stuff apparently. On draft day 2010, the Denver Broncos took a gamble on him with a 1st round draft pick under then-coach Josh McDaniels. A year or so passes, coach McDaniels is fired because the team isn’t doing too hot, new coach John Fox steps in, starting quarterback is hurt midway through another disappointing season… and then the backup Tebow steps in… and basically pulls off an amazing string of victories to not only get the Broncos into the playoffs, but give them a win over the Steelers too. Incredible! How was he rewarded for helping save the franchise? They sign Peyton Manning a few months later & trade him to the New York Jets (aka NFL’s 7th ring of hell). After a horrible year for that franchise, they release Tebow, his future in the NFL is questioned because his style isn’t the norm of the NFL… and now the most dominant franchise of the millennium is taking a chance on him. Also, he’s reunited with the coach that took a chance on him back in Denver, Josh McDaniels, who is now the Patriots offensive coordinator. How does the 25 year old feel about the whole experience? "I'm looking forward to working hard every single day, and getting a lot better, and learning under some great people," Tebow said during his 40-second visit with reporters. "So, that's all I got. But thank you so much and God bless. I'm sure we'll be talking more soon." There is no guarantee that Tebow will still be with the Patriots when training camp begins next month, but if the Patriots keep him, he would have time to develop as a quarterback since Brady holds that job. Tebow even could be tried at tight end, where the status of Rob Gronkowski is uncertain after he had his fourth operation on his broken left forearm on May 20 and faces back surgery this month. Whatever the situation may be with the Patriots, I wish Tim Tebow the best. He seems like a great guy who works hard & just wants to do great things & spread the word of Christ or whatever… and I’d much rather see him doing well than somebody who killed a pedestrian while driving drunk or is a repeatedly convicted woman beater or murderer or coke addict or any other potential Pro Bowler out there in the NFL. You know who you are… Best of luck, Timmy!
 
Coach Kidd – In semi-local news, Oakland born & raised basketball legend Jason Kidd retired earlier this week from the New York Knicks were he spent last season, his 19th season in the league… and fittingly enough, the same week that former co-Rookie of the Year Grant Hill decided to hang up his pro sneaks. Then came the real news!!! Just a few days later, the Brooklyn Nets hired Jason Kidd as their new head coach, bringing the former star back to the franchise he led to its greatest NBA success. The Nets decided to hire him to replace P.J. Carlesimo despite Kidd’s absence of coaching experience. "Jason Kidd has a long and legendary history with the Nets and with the city of New York," Nets owner Mikhail Prokhorov said in a statement. "He has the fire in the belly we need, and has achieved as a player everything the Brooklyn Nets are striving to achieve. We believe he will lead us there. Welcome home, Jason." The move reunites Kidd with the franchise he led to consecutive NBA Finals in 2002-03, when they played in New Jersey. He spent 6½ seasons with the Nets, averaging 14.6 points, 9.1 assists and 7.2 rebounds, and is their career leader in numerous statistical categories. "Jason is a proven winner and leader with an incredible wealth of basketball knowledge and experience," general manager Billy King said. "This will be a natural transition for him to move into the role of head coach, as he embodies the tough, smart and team-first mentality that we are trying to establish in Brooklyn." Terms of the deal that made Kidd the 18th coach in franchise history were not disclosed. The Nets will introduce Kidd on Thursday during a press conference at Barclays Center. It has been an interesting offseason for the Nets franchise. Coach Carlesimo wasn't retained after leading the Nets into the playoffs, where they lost to the Chicago Bulls in the first round. He went 35-19 after replacing Avery Johnson, who was fired in December. The 40-year-old Kidd was considered one of the smartest players in the NBA, which he believes will help him make the transition into coaching. "This is a tremendous opportunity to be named head coach of the Brooklyn Nets, and it's a role I have been studying for over the course of my playing days. Championship teams are built on being prepared, playing unselfishly and being held accountable, and that's how I expect to coach this basketball team." Kidd has a close friendship with Nets point guard Deron Williams and the respect of many in the organization for his achievements as a player. He is second on the NBA's career list in assists and steals (behind the great John Stockton), won an NBA title with Dallas and has two Olympic gold medals… now it’s on to his next challenge. Best of luck, Jason!
 
So with that, have a great weekend everybody & I’ll update you on adventures from this weekend as soon as possible!!!

LOTUS REGULATES TEMPERATURE LIKE ANIMALS

LOTUS CAN GENERATE HEAT AND
REGULATE ITS TEMPERATURE, STUDY
www.timesofindia.indiatimes.com - (New Delhi): Among other intriguing properties, the sacred lotus has the ability to generate heat and regulate its temperature like birds and mammals. This has been revealed by a team of researchers from University of Adelaide, who have unlocked the genetic secrets of one of the world's most unique and culturally significant plants, the lotus.
The work focused on its incredible ability to generate heat so that it can keep a constant temperature of around 32-34 degrees over a 2-3 day period, while the environmental temperature varies by up to 30 degrees - behaving like a warm-blooded animal. An international team has published its research in Genome Biology.

The scientific paper stated that the lotus has been cultivated as a food crop for more than 7,000 years in Asia and is prominent in both Buddhism and Hinduism. This sacred plant is noted for its long-lived seeds - viable for over 1,000 years - and for its water repellency and self-cleaning leaf surfaces. This 'lotus effect' is being adapted for industrial uses.
“The sacred lotus has huge cultural, religious, economic and medicinal importance and many unusual traits. It also has great scientific significance,” says professor Jenny Watling, head of the School of Earth and Environmental Sciences from University of Adelaide. “The heat generated and the aromas released are particularly attractive to pollinating insects,” added Watling.

An international team has sequenced and described the sacred lotus genome. The author of the article, Manash Pratim Gohain, explains that this study sheds new light on the evolutionary position of the lotus, one of the world's oldest flowering plants, and facilitates further research into its unusual characteristics. “We've found the biochemical pathway the lotus uses for this heat regulation. The plant can switch this pathway on or off, depending on whether it needs more or less heat ... so that it can keep a constant temperature - behaving like a warm-blooded animal,” says professor Jenny Watling. In most of the Hindus temples, the lotus flowers are used in decorations as a symbol of purity and beauty.

WHAT DO THE VEDIC TEACHINGS TELL US? 
Hindus have a special regard for the lotus flower, padma. Its one thousand petals have been associated with the mental convolutions, the chakras, finally culminating into Sahasrara, the highest stage of spiritual evolution. The lotus, which arises from mud roots and blooms in beauty, is a symbolic reminder of the emancipation of the mind from the low to the high. ... Lotus is considered special. The lotus flower, with its roots in the slush, rises up to bloom with beautiful petals. It occupies a very special place in Hindu theology. The highest meditation point, the Sahasrara chakra, is represented as the thousand-petal lotus flower. The lotus is regarded as the symbol of truth, compassion, and beauty - satyam, shivam, sunderam.


Dr. Hiro Badlani:
“Hinduism - Path of the Ancient Wisdom”
Chapter 52: “Symbols and Icons in Hinduism”
Chapter 53: “Hindu Customs”
http://hinduismpath.com/

Published by dasavatara das - "Vedic Views on World News"
http://www.vedicviews-worldnews.blogspot.com.ar/

Can TV writers go back and forth between sitcoms and dramas?



Happy Flag Day.  Many years ago on this date I joined the Army Reserves.  Amazingly, the country still exists.   Fly Old Glory and leave your Friday Questions in the comments section. Thanks. Here are today’s:

Dan Ball asks:

How easily can a TV writer go back and forth between sitcoms and dramas?

It’s never easy because writers get pigeonholed. Even if you’re established you might have

Thursday, June 13, 2013

Pregnant & Dating



In my eternal quest to find you the most idiotic reality shows, I present for your astonishment – PREGNANT & DATING. Who knew with a title like that that the show would be absurd? It airs on WE.

The show follows five pregnant available women. There’s Kiesha, formerly of the group Xscape… Shana, a former bikini model… Melissa, a fashion stylist… Megan, a knothead from the O.C. (“I went

Wednesday, June 12, 2013

Naughty Corn Dog Optical Illusion


Naughty Corn dog Optical Illusion

This is some what similar to Butterfly Optical Illusion, Always check your surroundings when eating a Corn Dog

[VN-News] : Nho cac ban giup do vote cho Ngoc Hoa so 136 cam on-vstarshow.com

 


 

 
được phép bình chọn mỗi 4 tiếng 1 lần (tối đa là 6 lần 1 ngày)-Số báo danh Ngọc Hoa:136
 
Ngoc Hoa


__._,_.___
Reply via web post Reply to sender Reply to group Start a New Topic Messages in this topic (2)
Recent Activity:
************************
VN - News !
Diễn đàn phổ biến và trao đỗi tin tức vs tất cả các vấn đề liên quang đến đất nước và con người VN.
Lưu ý:
+ Diễn đàn không chấp nhận "Cross Post", tức là post cùng một lúc đến với nhiều đí chỉ khác nhau.
+ Bài post phải trình bày gọn gàng sạch sẽ và rõ ràng.
+ Nội dung và ý kiến của thành viên không phải là lập trường chính kiến của diễn đàn.
*************************
.

__,_._,___
Good Afternoon Ladies & Gentlemen,
 
Saturday was Dizzy’s birthday… but the real celebration for her birthday will be next week. Stay tuned for details (it’s a secret & she reads the blog). Besides, this weekend her mom was in town… and her cousin was graduating high school… so it was more about family togetherness than her lasting another year of sexiness. Friday night, I met up for dinner with her & her mom so we went to our favorite $5.99 all-you-can-eat dim sum buffet in Chinatown. What’s the name of the place? Good question. It’s near the corner of Grant & Jackson though. We ate there, then we hung out at her place that evening watching an old TV show from the 90’s.
 
Now, “Due South” is a delightful little show that Dizzy turned me on to… though I swear I’ve seen the end credits before, so it was probably before something I used to watch in the mid-90’s. Anyway, it’s a comedic series about a mountie named Benton Fraser (Paul Gross) who goes to the mean streets of Chicago to look for his father’s killer (pilot) and then decides to stay there with the Canadian consulate. With his trusty wolf Diefenbaker, he pairs up with a local Italian-American stereotype detective and gets caught in all kinds of do-gooder shenanigans. Now, if you’re looking for intense cop drama, you’re not going to find it here… at all… like even a little bit. There are many plot holes, but it’s a fun little series about a sweet, honest, dedicated & infallible mountie and how he just tries to bring a little good & justice to the underprivileged of Chicago. Dizzy has loved it since she was a young’un… and I kinda think she sees a lot of Benton Fraser in me… you know, the whole tall good-looking sweet gentleman superhero thing. Anyway, I recommend checking out at least the first three episodes (the third one “Manhunt” has the great Leslie Nielsen as Buck Frobisher) and if you like it after that… you’re welcome.
 
Saturday, Dizzy went to the graduation while I slept in… we’ll say it’s because she couldn’t get any more tickets but… I’m not complaining. Afterwards though, we met up at California Pizza Kitchen for lunch with the family, then again in the evening we hung out at her aunt’s house for a few drinks & reminiscing… mostly about times before I came around, but it was still a LOT of fun. Sunday was pretty lazy… but that’s why I’m gonna fill you up with some newsy knowledge… and a super movie review.
 
Tuesday night, Dizzy, Angera & I went to see a special preview of “Man of Steel”, the new Superman reboot starring Henry Cavill (“The Tudors”) as Superman/Clark Kent, Amy Adams as Lois Lane, Michael Shannon as General Zod, Russell Crowe as Ja-Rel (bio daddy), Kevin Costner as Clark’s earth daddy, Diane Lane as Clark’s earth mama, and plenty of others in the cast like Laurence Fishburne, Harry Lennix, Christopher Meloni, Richard Schiff and on & on (and a superhot East German actress named Antje Traue, keep an eye on her). From the director of “300” & “Watchmen” Zach Snyder and the writer/producers of the “Dark Knight” trilogy, it was supposed to be a bit of a grittier more realistic Superman… and compared to the latest reboot from a few years ago, it definitely didn’t disappoint. The movie’s story is basically the combination of the original “Superman” (backstory of Krypton, intro of Superman) & “Superman II” (“KNEEL BEFORE ZOD!!!”) but is condensed into a 2.5 hour flick. This turns into the story being told in a lot of flashbacks, quick cuts, and can be a little off-putting & a little confusing at times… but overall, I’d say it was a pretty good flick. There’s a lot of action, some of which is pretty ridiculous & inconsistent… and plot holes abound… but this is Superman. I found it wildly entertaining, great score & tonal setting (I even broke a tear at one point), and the acting was very good. Henry Cavill does a great job of balancing the angsty side of a young Clark Kent with the charm that you’ve come to expect with Superman from the Christopher Reeve movies. Michael Shannon is pretty good as General Zod & the dichotomy of a man who will do anything to preserve his race, even if it means destroying most of it (just go with it) yet really fueled by vengeance at the same time. Amy Adams is cute… as she should be… but really the main thing I had with the movie is the INTENSE fight scenes & global destruction involved… with basically no repercussions. Spoiler alert/shocker: Manhattan (sorry Metropolis?) gets thoroughly throttled over the course of many epic battles… basically to the point of barren wasteland at the end of the final fight scene… yet during the resolution two minutes later, the Daily Planet is back to work like nothing happened. Now THAT’S a cleanup crew. Anyway, I would highly recommend going to watch the movie & I think everybody did a great job with it… but yeah, be ready to suspend your disbelief. P.S. There's a dragon...
 


Gats for Tots – In local news, Strobridge Elementary School in Hayward, California, held a toy-gun exchange program over the weekend, according to a report from CBS-5 San Francisco. Inspired by gun buy-back programs that focus on getting weapons off the streets, Principal Charles Hill felt a similar program for toys made a lot of sense. "Playing with toys guns, saying 'I'm going to shoot you,' desensitizes them," said Hill, "so, as they get older, it's easier for them to use a real gun." Students who participated were given books in exchange for their toy guns. They were also enrolled in a raffle to win a bike, the event's grand prize. CBS-5 spoke with parents who had brought their children to trade in their guns. One mother said she was always against toy guns, but she noted that her son felt left out when he saw the other kids playing with theirs. Some of the guns shown in the CBS-5 report were clearly fake, but others that were exchanged might easily have passed for real weapons. Police Officer Braydon Wilson, who was at the toy-gun exchange to talk to students about safety, told CBS-5 that sometimes kids will paint their toy guns to look like real ones. Other times, owners of real guns will paint the tip of the gun barrel orange to make it appear like a toy, according to Wilson. To sell to children? Hmm… I’m thinking that wasn’t the point of that last statement. The Daily Review spoke with Yih-Chau Chang, spokesperson for Responsible Citizens of California, a group that educates people about gun rights. "Having a group of children playing cops and robbers or cowboys and Indians is a normal part of growing up," Chang said to the Daily Review. "While the intentions are obviously good on the part of the school administration, this doesn't really educate children about guns or gun safety. Guns are used in crimes, but they are more often used in defensive ways, which prevent violent crime from occurring in the first place." So what do you think? Good idea? Bad idea? Personally I took two things away from this… I like the idea of trading toy guns for books to hopefully educate the kids… you know, fill their heads with little bullets of knowledge. Secondly, I also really like the idea of painting the tip of my real gun to orange so that people disregard it until I knee cap ‘em.  Some may say that it defeats the purpose of using a gun as a form of deterrence to coax somebody with an implied harmless gun but… I warned ‘em… they chose to call my bluff… pop-pop… pop-pop-pop-pop. G-u-NIT!!! Haha… sorry, apparently I’m the only one that thinks that’s funny. Well then, how about this next story?
 
Gats for Tots 2: Reloaded - Two would-be robbers met their match on Monday evening when they encountered a brave 10-year-old. (Note that in this story, the child is described as “brave”) It all began around 5:30 p.m. when the suspects, dressed in disguise, knocked on the door of the Brooklyn home. When two teenage girls opened the door, the two men pushed passed them, and headed upstairs, according to the Associated Press. When one of the suspects tried to enter a bedroom on the second floor, the 40-year-old home owner slammed the bedroom door on one of the home invaders arms, causing him to drop the gun. The owner's 10-year-old son grabbed the gun and fired a shot into the wall. One of the suspects fired back, without hitting anyone. The would-be robbers then ran off. Police are investigating, according to the AP story. They say other kids were in the house at the time but did not witness anything. (Jesus, how many kids were in the house?) So yeah, there’s an instance were a child holding a gun may have saved a life, right? Weird… Another brave boy also recently made news for his quick thinking during a home invasion. In Detroit, when burglars forced their way into Jaden Kanka’s home, the 9-year-old heard the intruders talking to his mom and boyfriend in the front of the house. He sneaked out the one-story bedroom window and ran to a neighbor, who called the police. The criminals were still in the home when police arrived and were quickly arrested. Where do I stand on gun laws? Look, if you know how to use them then maybe you should have one, just in case. It’s like an emergency kit in your car. You don’t want to have to use it… but it’s good to know it’s there when you need it. As far as kids with guns? Not until they’ve proven that they can learn to respect it… and even then, when they can afford to buy their own. Just like driving a car.
 
Drones: Taking More American Jobs – Drones are in the news a lot today… for many reasons. They’re being used in strategic threat elimination in wars overseas. They’re assisting with recognizance missions in otherwise uninhabitable areas from the wreckage of a fallen building to a nuclear hotspot at a nuclear power plant. They also remind many of those HK Killers from the Terminator movies & various other sci-fi mischief makers. However, now… in the present… this may be the next big threat to American jobs (such as eliminating strategic threats). TacoCopter turned out to be a fake. So did the Burrito Bomber. But now, the skies, at least in the U.K., have finally opened up to fast food: Domino's Pizza has carried out a delivery order by drone helicopter. Video of the DomiCopter—developed by Aerosight—was posted by T + Biscuits, the creative agency brought in by the pizza chain's U.K. headquarters. The copter reportedly can deliver up to two large pizzas over a four-mile radius in 10 minutes or less (which basically means all of San Francisco or Manhattan). “If anything, it went quicker than a pizza boy," T + Biscuits founder Tom Hatton told Fox News. "We were amazed at how easy it was going to be.” Of course, there are a few caveats about the drone delivery. First, it was not technically a drone mission. While Domino's said GPS coordinates could potentially be used in future delivery flights, this inaugural mission was controlled by an experienced drone copter pilot who had the benefit of several cameras to help guide the flight. Second, drone flights come with several restrictions in the U.S. For example, commercial drone flights are illegal in the U.S. until 2015. Why? You know why… Even then, in most states, drones can fly up to around 400 feet but must have the permission of landowners before entering private property. That could easily be handled by a one-click legal agreement with each online drone delivery order. But for now, the politics and science of drone food delivery remain complicated (and undiscussed really). In the meantime, Domino's U.K. says it will conduct further tests, including whether the drone can handle a larger payload to incorporate items such as 2-liter bottles of soda into future deliveries. Yes my friends… technology is making you fatter faster… and I think it’s great. I still expect my pizza to be cold, look like it’s been dropped a few times & somehow I’m pretty sure even the drone will give me the sh*t eye when I give them the tip.
 
 
Death of a Word – As you may know, I studied German for six years (well over a decade ago) and it has served me well… okay, actually it only came in handy watching “Inglorious Basterds” and other WWII movies… but still, I’m hopeful that one day it’ll help out. Anyway, the German language has one less long word to worry about… and it’s a doozy. "Rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz," a 65-letter word meaning "law delegating beef label monitoring," has been dropped following changes to European Union law regulating the testing of cattle, the BBC reports. The so-called "tapeworm" word—common in Germany—was introduced in 1999 during the bovine spongiform encephalopathy (aka "mad cow disease") crisis. But now that the EU has halted testing of "healthy cattle at abattoirs," the BBC said, "the need for the word vanished." With "rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz" ousted, the 49-letter  Donaudampfschifffahrtsgesellschaftskapitaenswitwe" ("widow of a Danube steamboat company captain") appears to have inherited the longest-word mantle, though it does not appear in the German standard language dictionary. The longest word found in there is "Kraftfahrzeughaftpflichtversicherung," or "automobile liability insurance." The longest word in the English language is the subject of nerdy debate, mostly over whether chemical terms should be considered words. The chemical name of the largest known protein, for instance, has 189,819 letters. (Last year, a man attempted to pronounce it in a three-hour, 30-minute YouTube video.) Really? Come on now, chemistry nerds… "Pneumonoultramicroscopicsilicovolcanoconiosis," a lung disease caused by inhaling very fine ash and sand dust, was the longest word to appear in a major dictionary when it turned up in the Webster's New International Dictionary in 1939. My money is on "Supercalifragilisticexpialidocious," a song from the 1964 Disney film "Mary Poppins," that appears in the Oxford English Dictionary. What does that mean? Absolutely nothing. German words are funny… but now we bid… that word, auf wiedersehen (until I see you later… because I’m pretty sure there’ll be another meat-born disease in Europe soon enough & then… that word will come back into everyday lexicon).
 
Bacon Update – Bacon & donuts! Everybody knows that bacon & donuts go together like… like bacon & eggs… or bacon & beer… or bacon & bleu cheese… or bacon & bacon. However, Dunkin’ Donuts wants everyone to have the opportunity to experience its new culinary creation. So the store has decided to begin selling its bacon, egg and doughnut sandwiches at all of its locations beginning June 7th. The sandwich contains a fried egg and slices of smoked bacon stuffed between the halves of a sliced, glazed doughnut. “The glazed doughnut is light and fluffy and gives you just the right amount of sweetness,” says Dunkin’ Executive Chef Stan Frankenthaler. “Combined with the lightly salted, smoked bacon, the texture and flavors marry together in a wonderful way. It’s a delicious bite of the perfect harmonization of sweet and savory flavors.” And the timing is perfect, as June 7 was also the too-good-to-be-true holiday National Doughnut Day. As it turns out, Dunkin' is not the first operation to produce a doughnut-based sandwich. The Illinois minor league baseball team the Gateway Grizzlies has been selling a doughnut hamburger, using Krispy Kremes in place of traditional buns. The ballpark says it sells 100-200 of the sandwiches each game night for $4.50 each. However, the bacon donut sandwich is not the avalanche of calories some might expect. In fact, it clocks in at only 360 calories, less than Dunkin’s turkey sausage sandwich (390 calories), which is marketed at more health conscious consumers. Then again, we’re talking about comparing Dunkin’ Donuts to Dunkin’ Donuts. Interestingly, food chains that offer lower-calorie dining options saw an 11% spike in sales last year, while those that didn’t saw a 15% drop in sales, according to information released by the Hudson Institute. However, as the AP notes, over-the-top food options have proved incredibly popular as well. For example, Taco Bell said its Doritos Locos Taco has proved to be its most successful item ever, boosting the chain’s overall sales by 8% in 2012 (and that’s some SERIOUS coin for a staple chain like Taco Bell). And if that's the case, the bacon doughnut might just prove to be a strong addition for Dunkin' Donuts, which already generated some $5.5 billion in 2012 across its 7,015 U.S. locations. What’s the point? Bacon sells! And yes… I kinda want bacon egg & donut sandwiches to be part of the next Bacon Day…
 
What’s that? WHEN IS THE NEXT BACON DAY? Well, in honor of the great thespian & Philadelphia’s own Kevin Norwood Bacon’s 55th birthday coming up in early July (and basically the one year anniversary of the idea), we are throwing the next Bacon Day within the next month. Really just trying to decide between the two weekends before & after… and just in time to introduce two new roommates to the incredible event!!! So if you’re interested, let me know & I’d be happy to send you the details. We’d love to host you & share our delicious treats with you.
 
Aside from that, not a whole lot more else to say, work is work, play is play, tomorrow is another day! Have a great day everybody!!!

[VN-News] Nho cac ban giup do vote cho Ngoc Hoa so 136 cam on-vstarshow.com

 

 
được phép bình chọn mỗi 4 tiếng 1 lần (tối đa là 6 lần 1 ngày)-Số báo danh Ngọc Hoa:136
 
Ngoc Hoa

__._,_.___
Reply via web post Reply to sender Reply to group Start a New Topic Messages in this topic (1)
Recent Activity:
************************
VN - News !
Diễn đàn phổ biến và trao đỗi tin tức vs tất cả các vấn đề liên quang đến đất nước và con người VN.
Lưu ý:
+ Diễn đàn không chấp nhận "Cross Post", tức là post cùng một lúc đến với nhiều đí chỉ khác nhau.
+ Bài post phải trình bày gọn gàng sạch sẽ và rõ ràng.
+ Nội dung và ý kiến của thành viên không phải là lập trường chính kiến của diễn đàn.
*************************
.

__,_._,___

[syiar-islam] Kenaikan Harga BBM Menambah Kemiskinan dan Kejahatan

 

Kalau kita lihat data statistik BPS, mobil pribadi itu cuma 9,5 juta. Itu pun mungkin 80% adalah mobil2 tua yg tak layak jalan. Sisanya adalah truk, bis, dan 68 juta Sepeda Motor. Sepeda Motor itu kurang nyaman dan aman. Boleh dikata 90% pemakainya adalah orang2 miskin yg tak mampu naik bis/KRL karena ongkos kendaraan umum mahal. Dibanding jumlah rakyat yg 242 juta jiwa, jelas pemilik mobil pribadi itu kurang dari 5%. Artinya 95% subsidi itu sudah tepat sasaran. Kalau mau mengambil 5% Subsidi yg salah sasaran, kenakan saja pajak STNK yg tinggi bagi pemilik kendaraan pribadi. Misalnya 10% dari harga yg beli. Misalnya dia beli mobil Rp 1 milyar. Dia harus bayar pajak Rp 100 juta. Artinya itu bisa menutupi 10.000 liter bensin/tahun atau hampir 300 liter bensin/hari. Jangan sampai pengurangan subsidi menyengsarakan 80% rakyat menengah ke bawah karena kenaikan harga2 lainnya 

Kenaikan harga BBM akan memiskinkan rakyat karena harga2 barang otomatis akan naik. Sementara pendapatan rakyat tak meningkat. BLSM pun cuma 5 bulan dgn besar rp 150 ribu/bulan: 

http://infoindonesia.wordpress.com/2007/11/16/kemiskinan-akibat-kenaikan-harga-bbm/

Kemiskinan Meningkat, Kriminalitas juga naik: Kompas.com, 28-5-2008 – Lembaga Ilmu Penelitian Indonesia (LIPI) memperkirakan angka kriminalitas akan meningkat sebagai dampak kenaikan harga bahan bakar minyak (BBM).

"Kenaikan harga BBM hampir pasti akan menyebabkan semakin sempitnya lapangan kerja baru akibatkan pengangguran bertambah, dan yang jelas akan memicu angka kriminalitas," kata Peneliti P2E LIPI Dr Wijaya Adi di Jakarta, Rabu (28/5).

Dia mencontohkan, ketika Pemerintah menaikkan harga BBM tahun 2005 lalu angka kriminalitas juga naik. Data Badan Pusat Statistik (BPS) menunjukkan jumlah tindak pidana 2005 sebesar 256.431 kasus, sedangkan sebelum menaikkan harga BBM, tepatnya 2004, angka kriminal 220.886 kasus. "Dengan kata lain angkanya naik 16,09 persen," katanya. 

http://infoindonesia.wordpress.com/2008/05/29/lipi-kenaikan-bbm-picu-kriminalitas/

Harusnya korupsi, gaji raksasa pejabat dulu yg dihapus. Lihat bagaimana gaji pejabat BUMN/Gubernur BI bisa lebih dari RP 200 juta/bulan. Belum sabetannya: 

http://infoindonesia.wordpress.com/2009/11/05/gaji-raksasa-pejabat-pemerintah-dan-swasta-vs-kemiskinan-rakyat/

Untuk gaji2 besar pejabat, fasilitas rumah dan mobil mewah pejabat, studi banding milyaran rupiah, pemerintah selalu punya uang banyak. Tak ada rasa sense of crisis.

Tapi saat bicara "Subsidi" untuk rakyat, pemerintah seperti tidak punya uang sama sekali. Tiba2 sense of crisisnya tinggi sekali... :)

Harga BBM di Indonesia (RON 95) 2x lipat lebih tinggi dari Malaysia. Padahal pendapatan rakyat Malaysia 4x lipat rakyat Indonesia:
http://en.wikipedia.org/wiki/Gasoline_and_diesel_usage_and_pricing RON 95: Indonesia 1.22$/ltr, Malaysia 0.6$/ltr , Vietnam 1.11 . Venezuela 0.015

Banyak Mismanagement/Salah Urus minyak di Indonesia yang harus dibenahi dulu. Solusinya: Nasionalisasi Semua perusahaan minyak di Indonesia. Biar semuanya dikelolah oleh 3 BUMN minyak agar bisa bersaing. Dgn dikuasai oleh perusahaan minyak asing, Produksi minyak di Indonesia di era Soeharto yang 1,5 juta bph sekarang turun jadi 0,8 juta bph setelah kontrol minyak diserahkan dari Pertamina ke BP Migas. 

Begitu pula minyak kurang, kok malah ekspor? Itu harus dibenahi dulu. Baru kita bicara tentang pengurangan Subsidi BBM.

http://infoindonesia.wordpress.com/2012/04/11/mismanagementsalah-urus-minyak-di-indonesia/

Produksi Minyak Minim, Tapi Kok RI Ekspor Minyak? "Negara-negara yang membeli produksi minyak Indonesia di antaranya Jepang, Amerika Serikat, Korea, Taiwan, Singapura dan lainnya. Jepang merupakan negara terbesar pembeli minyak Indonesia yakni pada 2010 mencapai 19,3% dari total ekspor minyak atau mencapai 23.407 ribu barel sedangkan pada 2011 sekitar 36.823 ribu barel (36,6%), sementara Amerika pada 2010 membeli minyak Indonesia sebanyak 4.779 ribu barel dan pada 2011 sekitar 5.553 ribu barel," demikian pernyataan Ditjen Migas. http://finance.detik.com/read/2012/04/10/123316/1888718/1034/produksi-minyak-minim-tapi-kok-ri-ekspor-minyak

Aneh juga melihat produksi minyak Indonesia yang kian menurun. Tahun 1973-2000 produksi ratarata minyak Indonesia mencapai 1,5 juta bph (REPUBLIKA :: 04 April 2012). Ini terjadi saat Pertamina masih memegang kontrol yang kuat atas para operator.

Namun semenjak Pertamina dilemahkan pada era Reformasi, produksi minyak justru melorot hingga 0,8 juta bph.

"Ada yang bilang produksi minyak (lifting) 950.000 barel per hari (bph), bahkan saat ini turun 930.000 bph, atau bahkan pada jaman Presiden Suharto 1,4 juta bph. Jujur saya tidak percaya, pasalnya siapa yang menentukan lifting produksi minyak kita," kata Fuad di Kantor Wilayah DJP Wajib Pajak Besar Gambir, Senin (2/4/2012). http://finance.detik.com/read/2012/04/02/143757/1882885/4/dirjen-pajak-tak-percaya-lifting-minyak-indonesia

Ada yg bilang sumbernya habis.

Kalau habis niscaya pada hengkang pak perusahaan2 minyak AS tsb. Nyatanya pendapatan mereka naik terus sehingga Exxon dan Chevron masuk 10 perusahaan terkaya di dunia versi Forbes 500
11 hours ago · Like

Lihat kenaikan keuntungan Exxon sampai 35% jadi $41.1 billion (Rp 410 trilyun): http://money.cnn.com/magazines/fortune/fortune500/2012/snapshots/387.html

Ini 1 contoh kecurangan laporan. Jumlah produksi cuma dilaporkan 1/4 saja: Agus Marto Wardojo: Dia juga mengemukakan, saat ini pemerintah mensinyalir adanya indikasi ekspor ilegal. Dalam catatannya, di salah satu industri pertambangan, dalam satu tahun Indonesia hanya bisa ekspor 5 juta ton pada sebuah kawasan. "Ternyata di luar, impor dari Indonesia mineral itu 20 juta ton per tahun. Kan sayang sekali itu, kalau yang tercatat ekspor 5 juta ton tetapi jumlah yang diimpor dari Indonesia sampai 20 juta ton, artinya jadi ekspor ilegal dong," tambahnya. http://bisniskeuangan.kompas.com/read/2011/04/22/10264265/Ini.Alasan.Pemerintah.Beli.Saham.Newmont

Exxon saat disuruh Pertamina mengeksplorasi blok Migas Cepu lapor kalau tak ada cadangan migas di sana. Ternyata usai Reformasi, Exxon malah merebut blog Migas Cepu karena cadangannya amat banyak. Pak Marwan Batubara tahu hal ini. Nah di Jawa saja, blok Migas belum dieksplor habis. Lapindo itu jelek2nya banyak gasnya lho. Makanya ada api dan semburannya. Itu Jawa yg padat penduduknya. Belum Natuna, Sumatera, Kalimantan, Papua, Sulawesi, dsb.

Arab Saudi cukup cerdas menasionalisasi perusahaan Aramco tahun 1974. Tahun 1970-an, Arab Saudi masih termasuk negara miskin. Kekayaan alam mereka berupa minyak tidak dapat mensejahterakan mereka karena dikuasai perusahaan AS, Aramco. Namun sejak raja Faisal menasionalisasi Aramco, maka seluruh hasil minyak dapat dinikmati oleh rakyat Saudi Arabia. Jumlah uang yang masuk untuk pembangunan pun berlimpah sehingga listrik di sana gratis, sementara bensin cuma Rp 1700/liter. Ini jauh lebih murah ketimbang Indonesia yang Rp 4.500/liter saja sudah ribut soal kurangnya subsidi karena 90% migas kita dikuasai perusahaan migas asing. http://infoindonesia.wordpress.com/2009/06/30/selama-kekayaan-alam-dirampok-asing-indonesia-akan-terus-miskin/

http://www.bps.go.id/tab_sub/view.php?tabel=1&daftar=1&id_subyek=17¬ab=12
.
===
Belajar Islam sesuai Al Qur'an dan Hadits di http://media-islam.or.id

Buat website mulai 1 Dinar (Rp 2,4 juta) http://media-islam.or.id/2010/07/22/pembuatan-website-seharga-2-dinar

Bagi yg ingin turut membantu www.media-islam.or.id DSB, bisa transfer mulai rp 5 ribu ke : Rekening BCA No 0061947069 a/n Agus Nizami dan konfirmasi. Mudah2an bisa jadi sedekah kita sbg ilmu yg bermanfaat.
Milis Syiar Islam: syiar-islam-subscribe@yahoogroups.com

__._,_.___
Reply via web post Reply to sender Reply to group Start a New Topic Messages in this topic (1)
Recent Activity:
===


Untuk berlangganan milis Syiar Islam, kirim email ke:
syiar-islam-subscribe@yahoogroups.com
Layanan pembuatan website mulai 1 Dinar: http://media-islam.or.id/2010/07/22/pembuatan-website-seharga-3-dinar

Paket Umrah 2011 mulai US$ 1.700/orang di http://media-islam.or.id/2011/01/24/paket-umroh-2011-mulai-us-1-400

AhliHerbal.com Situs Belanja Herbal Terpercaya: http://ahliherbal.com
.

__,_._,___

[syiar-islam] Nabi Muhammad MengIslamkan Orang2 Kafir

 

Assalamu'alaikum wr wb,

Saat Muhammad jadi Nabi, semua orang di sekitar Nabi Muhammad adalah Kafir. Tugas Nabi adalah mendakwahkan Islam kepada mereka dgn cara yg baik sehingga akhirnya seluruh jazirah Arab masuk ke dalam Islam. Jadi bukan malah membenci dan membunuh orang2 kafir. Kalau orang2 kafir dibunuh, lalu siapa yg harus diIslamkan?

Serulah (manusia) kepada jalan Tuhanmu dengan hikmah dan pelajaran yang baik dan bantahlah mereka dengan cara yang baik…" (QS An-Nahl: 125).

"Sesungguhnya telah ada pada (diri) Rasulullah itu suri teladan yang baik bagimu…" [Al Ahzab 21]

"Maka disebabkan rahmat dari Allah-lah kamu berlaku lemah lembut terhadap mereka. Sekiranya kamu bersikap keras lagi berhati kasar, tentulah mereka menjauhkan diri dari sekelilingmu. Karena itu ma'afkanlah mereka, mohonkanlah ampun bagi mereka, dan bermusyawaratlah dengan mereka dalam urusan itu…" [Ali 'Imran 159]

"Dan tidaklah sama kebaikan dan kejahatan. Tolaklah (kejahatan itu) dengan cara yang lebih baik, maka tiba-tiba orang yang antaramu dan antara dia ada permusuhan seolah-olah telah menjadi teman yang sangat setia.

Sifat-sifat yang baik itu tidak dianugerahkan melainkan kepada orang-orang yang sabar dan tidak dianugerahkan melainkan kepada orang-orang yang mempunyai keuntungan yang besar." [Fushshilat 34-35]

Nabi melakukan dakwah dengan cara yang baik dan bijak.

وَمَا أَرْسَلْنَاكَ إِلا رَحْمَةً لِلْعَالَمِينَ
"Dan tiadalah Kami mengutus engkau (Muhammad) melainkan untuk (menjadi) rahmat bagi semesta alam." (QS Al-Anbiyaa : 107)

Baca selengkapnya di: http://media-islam.or.id/2012/11/30/cara-nabi-berdakwah-islam/

.
===
Belajar Islam sesuai Al Qur'an dan Hadits di http://media-islam.or.id

Buat website mulai 1 Dinar (Rp 2,4 juta) http://media-islam.or.id/2010/07/22/pembuatan-website-seharga-2-dinar

Bagi yg ingin turut membantu www.media-islam.or.id DSB, bisa transfer mulai rp 5 ribu ke : Rekening BCA No 0061947069 a/n Agus Nizami dan konfirmasi. Mudah2an bisa jadi sedekah kita sbg ilmu yg bermanfaat.
Milis Syiar Islam: syiar-islam-subscribe@yahoogroups.com

__._,_.___
Reply via web post Reply to sender Reply to group Start a New Topic Messages in this topic (1)
Recent Activity:
===


Untuk berlangganan milis Syiar Islam, kirim email ke:
syiar-islam-subscribe@yahoogroups.com
Layanan pembuatan website mulai 1 Dinar: http://media-islam.or.id/2010/07/22/pembuatan-website-seharga-3-dinar

Paket Umrah 2011 mulai US$ 1.700/orang di http://media-islam.or.id/2011/01/24/paket-umroh-2011-mulai-us-1-400

AhliHerbal.com Situs Belanja Herbal Terpercaya: http://ahliherbal.com
.

__,_._,___